PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10427932g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 340aa    MW: 38163.6 Da    PI: 8.7612
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10427932g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.71.2e-3251107259
       ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       ++vrY+eC+kNhAa++Gg a+DGCgEfmps geegt +alkC+AC+CHRnFHRreve 
  MA_10427932g0010  51 KTVRYRECMKNHAAAMGGSATDGCGEFMPS-GEEGTLEALKCSACECHRNFHRREVEG 107
                       689**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2353108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.7E-2953105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-2954105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.29555104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.2E-19184228IPR009057Homeodomain-like
SuperFamilySSF466891.61E-9184228IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-17185228IPR006455Homeodomain, ZF-HD class
SuperFamilySSF466891.55E-11246299IPR009057Homeodomain-like
TIGRFAMsTIGR015651.9E-19247299IPR006455Homeodomain, ZF-HD class
Gene3DG3DSA:1.10.10.601.7E-21247298IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDLGGQDGAE IPMPMPMSTG SFIHESSTNL LINNVNAGPL HIEEEQIKSK KTVRYRECMK  60
NHAAAMGGSA TDGCGEFMPS GEEGTLEALK CSACECHRNF HRREVEGEPS CDCFRIRDQL  120
NRKRSGVLVS SRAQGAAAIA PDPFAFPPNN LLPRLPPQAI MSYSTGPSES DELEGTFLSR  180
PAILKKRFRT KFTQEQKDRM LDFAEKVGWR IQKHDEQAVQ QFCQDIGMRF IFSVPDETFL  240
SRPAILKKRF RTKFTQQQKD RMLNFAEKVG WTIQKYDGQV VQQFCQDIGV KRRVLKVFIC  300
RASLGREKSC TFEGNVLPVR ASNLSTVVLN SKGWSTAAAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A8e-161842991669ZF-HD homeobox family protein
1wh7_A7e-161862991869ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0834880.0EF083488.1 Picea sitchensis clone WS02718_I10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252306.13e-72PREDICTED: zinc-finger homeodomain protein 4
SwissprotQ9M9S01e-49ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA9NQC41e-171A9NQC4_PICSI; Putative uncharacterized protein
STRINGPOPTR_0003s00800.14e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.27e-48homeobox protein 31